PDBi (Protein Data Bank in India)

All in One Protein Databank
Home About Help Resources External Links Contact Us
Advanced Search
FASTA Sequence PDB Format mmCIF Format
FASTA Sequence PDB Format PDB Format(gz) PDBx/mmCIF Format PDBx/mmCIF Format(gz) PDBML/XML Format Validation Full PDF Validation CIF

5OB2

Crystal structure of the c-src-sh3 domain e97t mutant in complex with the high affinity peptide app12

PDB DOI: 10.2210/pdb5ob2/pdb

Classification: TRANSFERASE
Organism(s): Caldanaerobius , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)

Deposited: 2017-06-25
Deposition Author(s): Camara-Artigas, A.

Experimental Data Snapshot

Method: X-RAY DIFFRACTION
Resolution: 1.8 Å

5ob2
Literature

Crystal structure of the c-src-sh3 domain e97t mutant in complex with the high affinity peptide app12

Camara-Artigas, A.

Primary Citation of Related Structures: 5OB2


Proteins
Molecule Chains Sequence Length Organism Sequence
Proto-oncogene tyrosine-protein kinase Src A 61 Caldanaerobius , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) GSHMTFVALYDYESRTTTDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPSD
Proto-oncogene tyrosine-protein kinase Src C 61 Caldanaerobius , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) GSHMTFVALYDYESRTTTDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPSD
APP12 B 13 Caldanaerobius , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) XAPPLPPRNRPRL
APP12 D 13 Caldanaerobius , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) XAPPLPPRNRPRL
Experimental Data

Method: X-RAY DIFFRACTION

Deposited Date: 2017-06-25
Deposition Author(s): Camara-Artigas, A.