Crystal structure of the c-src-sh3 domain e97t mutant in complex with the high affinity peptide app12
PDB DOI: 10.2210/pdb5ob2/pdb
Classification: TRANSFERASE Organism(s): Gallus Gallus , Synthetic Construct
Deposited: 2017-06-25 Deposition Author(s): Camara-Artigas, A.
Method: X-RAY DIFFRACTION Resolution: 1.8 Å
Crystal structure of the c-src-sh3 domain e97t mutant in complex with the high affinity peptide app12
Primary Citation of Related Structures: 5OB2
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Proto-oncogene tyrosine-protein kinase Src | A | 61 | Gallus Gallus , Synthetic Construct | GSHMTFVALYDYESRTTTDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPSD |
| Proto-oncogene tyrosine-protein kinase Src | C | 61 | Gallus Gallus , Synthetic Construct | GSHMTFVALYDYESRTTTDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPSD |
| APP12 | B | 13 | Gallus Gallus , Synthetic Construct | XAPPLPPRNRPRL |
| APP12 | D | 13 | Gallus Gallus , Synthetic Construct | XAPPLPPRNRPRL |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-06-25 Deposition Author(s): Camara-Artigas, A.