The cryofrozen atomic resolution x-ray crystal structure of perdeuterated pyrococcus furiosus rubredoxin (100k, 0.59a resolution)
PDB DOI: 10.2210/pdb5nw3/pdb
Classification: ELECTRON TRANSPORT Organism(s): Pyrococcus Furiosus (Strain Atcc 43587 / Dsm 3638 / Jcm 8422 / Vc1)
Deposited: 2017-05-04 Deposition Author(s): Cuypers, M.G. , Forsyth, V.T. , Haertlein, M. , Mason, S.A. , Mossou, E.
Method: X-RAY DIFFRACTION Resolution: 0.59 Å
The cryofrozen atomic resolution x-ray crystal structure of perdeuterated pyrococcus furiosus rubredoxin (100k, 0.59a resolution)
Cuypers, M.G. , Forsyth, V.T. , Haertlein, M. , Mason, S.A. , Mossou, E.
Primary Citation of Related Structures: 5NW3
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Rubredoxin | A | 54 | Pyrococcus Furiosus (Strain Atcc 43587 / Dsm 3638 / Jcm 8422 / Vc1) | MAKWVCKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFEKLED |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-05-04 Deposition Author(s): Cuypers, M.G. , Forsyth, V.T. , Haertlein, M. , Mason, S.A. , Mossou, E.