Crystal structure of the protein-kinase a catalytic subunit from criteculus griseus in complex with compound rkp032
PDB DOI: 10.2210/pdb5ntj/pdb
Classification: TRANSFERASE Organism(s): Cricetulus Griseus , Synthetic Construct
Deposited: 2017-04-28 Deposition Author(s): Heine, A. , Klebe, G. , Mueller, J.M.
Crystal structure of the protein-kinase a catalytic subunit from criteculus griseus in complex with compound rkp032
Heine, A. , Klebe, G. , Mueller, J.M.
Primary Citation of Related Structures: 5NTJ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| cAMP-dependent protein kinase catalytic subunit alpha | A | 353 | Cricetulus Griseus , Synthetic Construct | GHMGNAAAAKKGSEQESVKEFLAKAKEEFLKKWESPSQNTAQLDHFDRIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFTEF |
| cAMP-dependent protein kinase inhibitor | B | 18 | Cricetulus Griseus , Synthetic Construct | TTYADFIASGRTGSRNAI |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-04-28 Deposition Author(s): Heine, A. , Klebe, G. , Mueller, J.M.