The structure of ll-37 crystallized in the presence ldao
PDB DOI: 10.2210/pdb5nnk/pdb
Classification: ANTIMICROBIAL PROTEIN Organism(s): N.A.
Deposited: 2017-04-10 Deposition Author(s): Sancho-Vaello, E. , Zeth, K.
The structure of ll-37 crystallized in the presence ldao
Primary Citation of Related Structures: 5NNK
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Cathelicidin antimicrobial peptide | A | 37 | N.A. | [LL-37, 37 aa] |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-04-10 Deposition Author(s): Sancho-Vaello, E. , Zeth, K.