Atomic resolution structure of ll-37 in a monomeric state
PDB DOI: 10.2210/pdb5nmn/pdb
Classification: ANTIMICROBIAL PROTEIN Organism(s): N.A.
Deposited: 2017-04-06 Deposition Author(s): Sancho-Vaello, E. , Zeth, K.
Method: X-RAY DIFFRACTION Resolution: 0.95 Å
Atomic resolution structure of ll-37 in a monomeric state
Primary Citation of Related Structures: 5NMN
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Cathelicidin antimicrobial peptide | A | 37 | N.A. | [LL-37, 37 aa] |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-04-06 Deposition Author(s): Sancho-Vaello, E. , Zeth, K.