Solution structure of the c-terminal domain of s. aureus hibernating promoting factor (ctd-sahpf)
PDB DOI: 10.2210/pdb5nko/pdb
Classification: RIBOSOMAL PROTEIN Organism(s): Staphylococcus Aureus (Strain Nctc 8325)
Deposited: 2017-03-31 Deposition Author(s): Ayupov, R.K. , Khusainov, I.S. , Kieffer, B. , Usachev, K.S. , Validov, S.Z. , Yusupov, M.M.
Solution structure of the c-terminal domain of s. aureus hibernating promoting factor (ctd-sahpf)
Ayupov, R.K. , Khusainov, I.S. , Kieffer, B. , Usachev, K.S. , Validov, S.Z. , Yusupov, M.M.
Primary Citation of Related Structures: 5NKO
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Ribosome hibernation promotion factor | A | 61 | Staphylococcus Aureus (Strain Nctc 8325) | MIEIIRSKEFSLKPMDSEEAVLQMNLLGHDFFVFTDRETDGTSIVYRRKDGKYGLIQTSEQ |
Ribosome hibernation promotion factor | B | 61 | Staphylococcus Aureus (Strain Nctc 8325) | MIEIIRSKEFSLKPMDSEEAVLQMNLLGHDFFVFTDRETDGTSIVYRRKDGKYGLIQTSEQ |
Method: SOLUTION NMR
Deposited Date: 2017-03-31 Deposition Author(s): Ayupov, R.K. , Khusainov, I.S. , Kieffer, B. , Usachev, K.S. , Validov, S.Z. , Yusupov, M.M.