The 1.06 a resolution structure of the l16g mutant of ferric cytochrome c prime from alcaligenes xylosoxidans, complexed with nitrite
PDB DOI: 10.2210/pdb5ngx/pdb
Classification: OXIDOREDUCTASE Organism(s): Alcaligenes Xylosoxydans Xylosoxydans
Deposited: 2017-03-20 Deposition Author(s): Horrell, S. , Hough, M. , Kekelli, D. , Moreno Chicano, T. , Strange, R.
The 1.06 a resolution structure of the l16g mutant of ferric cytochrome c prime from alcaligenes xylosoxidans, complexed with nitrite
Horrell, S. , Hough, M. , Kekelli, D. , Moreno Chicano, T. , Strange, R.
Primary Citation of Related Structures: 5NGX
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Cytochrome c' | A | 126 | Alcaligenes Xylosoxydans Xylosoxydans | QFAKPEDAVKYRQSAGTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-03-20 Deposition Author(s): Horrell, S. , Hough, M. , Kekelli, D. , Moreno Chicano, T. , Strange, R.