Structure of the c-terminal domain of the escherichia coli proq rna binding protein
PDB DOI: 10.2210/pdb5nbb/pdb
Classification: CHAPERONE Organism(s): Helicobacter Pylori Bacteriophage Khp30
Deposited: 2017-03-01 Deposition Author(s): Bateman, A. , Broadhurst, R. , Gonzales, G. , Hardwick, S. , Holmqvist, E. , Luisi, B. , Maslen, S. , Skehel, M. , Vogel, J.
Method: SOLUTION NMR Resolution: N.A.
Structure of the c-terminal domain of the escherichia coli proq rna binding protein
Bateman, A. , Broadhurst, R. , Gonzales, G. , Hardwick, S. , Holmqvist, E. , Luisi, B. , Maslen, S. , Skehel, M. , Vogel, J.
Primary Citation of Related Structures: 5NBB
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
RNA chaperone ProQ | A | 53 | Helicobacter Pylori Bacteriophage Khp30 | VSDISALTVGQALKVKAGQNAMDATVLEITKDGVRVQLNSGMSLIVRAEHLVF |
Method: SOLUTION NMR
Deposited Date: 2017-03-01 Deposition Author(s): Bateman, A. , Broadhurst, R. , Gonzales, G. , Hardwick, S. , Holmqvist, E. , Luisi, B. , Maslen, S. , Skehel, M. , Vogel, J.