Structure of the n-terminal domain of the escherichia coli proq rna binding protein
PDB DOI: 10.2210/pdb5nb9/pdb
Classification: RNA Organism(s): Escherichia Coli O45:K1 (Strain S88 / Expec)
Deposited: 2017-03-01 Deposition Author(s): Bateman, A. , Broadhurst, R. , Gonzales, G. , Hardwick, S. , Holmqvist, E. , Luisi, B. , Maslen, S. , Skehel, M. , Vogel, J.
Structure of the n-terminal domain of the escherichia coli proq rna binding protein
Bateman, A. , Broadhurst, R. , Gonzales, G. , Hardwick, S. , Holmqvist, E. , Luisi, B. , Maslen, S. , Skehel, M. , Vogel, J.
Primary Citation of Related Structures: 5NB9
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| RNA chaperone ProQ | A | 133 | Escherichia Coli O45:K1 (Strain S88 / Expec) | MGSSHHHHHHSQDPMENQPKLNSSKEVIAFLAERFPHCFSAEGEARPLKIGIFQDLVDRVAGEMNLSKTQLRSALRLYTSSWRYLYGVKPGATRVDLDGNPCGELDEQHVEHARKQLEEAKARVQAQRAEQQA |
Method: SOLUTION NMR
Deposited Date: 2017-03-01 Deposition Author(s): Bateman, A. , Broadhurst, R. , Gonzales, G. , Hardwick, S. , Holmqvist, E. , Luisi, B. , Maslen, S. , Skehel, M. , Vogel, J.