Nmr structure of tlr4 transmembrane domain (624-657) in dpc micelles
PDB DOI: 10.2210/pdb5nao/pdb
Classification: SIGNALING PROTEIN Organism(s): Homo Sapiens
Deposited: 2017-02-28 Deposition Author(s): Arseniev, A.S. , Goncharuk, M.V. , Goncharuk, S.A. , Mineev, K.S.
Nmr structure of tlr4 transmembrane domain (624-657) in dpc micelles
Arseniev, A.S. , Goncharuk, M.V. , Goncharuk, S.A. , Mineev, K.S.
Primary Citation of Related Structures: 5NAO
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Toll-like receptor 4 | A | 35 | Homo Sapiens | MNITSQMNKTIIGVSVLSVLVVSVVAVLVYKFYFH |
Method: SOLUTION NMR
Deposited Date: 2017-02-28 Deposition Author(s): Arseniev, A.S. , Goncharuk, M.V. , Goncharuk, S.A. , Mineev, K.S.