Crystal structure of the dbl-homology domain of bcr-abl in complex with monobody mb(bcr-dh_4).
PDB DOI: 10.2210/pdb5n7e/pdb
Classification: SIGNALING PROTEIN Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2017-02-20 Deposition Author(s): Hantschel, O. , Pojer, F. , Reckel, S. , Reynaud, A.
Crystal structure of the dbl-homology domain of bcr-abl in complex with monobody mb(bcr-dh_4).
Hantschel, O. , Pojer, F. , Reckel, S. , Reynaud, A.
Primary Citation of Related Structures: 5N7E
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Mb(Bcr-DH_4) | A | 95 | Homo Sapiens , Synthetic Construct | SVSSVPTKLEVVAATPTSLLISWDAPAVTVDLYVITYGETGGNSPVQEFEVPGSKSTATISGLKPGVDYTITVYAGSYAYEYYWGPSPISINYRT |
| Breakpoint cluster region protein | B | 219 | Homo Sapiens , Synthetic Construct | GAMASELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTSQQIETIFFKVPELYEIHKEFYDGLFPRVQQWSHQQRVGDLFQKLASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDAKDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLLQDALRISQNFLSSINEEITPRRQSMTVK |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-02-20 Deposition Author(s): Hantschel, O. , Pojer, F. , Reckel, S. , Reynaud, A.