Crystal structure of the lectin leca from pseudomonas aeruginosa in complex with a phenyl-epoxy-galactopyranoside
PDB DOI: 10.2210/pdb5mih/pdb
Classification: SUGAR BINDING PROTEIN Organism(s): Pseudomonas Aeruginosa (Strain Atcc 15692 / Dsm 22644 / Cip 104116 / Jcm 14847 / Lmg 12228 / 1C / Prs 101 / Pao1)
Deposited: 2016-11-28 Deposition Author(s): Hauk, D. , Hofmann, M. , Imberty, A. , Joachim, I. , Muller, R. , Sommer, R. , Titz, A. , Varrot, A. , Wagner, S.
Crystal structure of the lectin leca from pseudomonas aeruginosa in complex with a phenyl-epoxy-galactopyranoside
Hauk, D. , Hofmann, M. , Imberty, A. , Joachim, I. , Muller, R. , Sommer, R. , Titz, A. , Varrot, A. , Wagner, S.
Primary Citation of Related Structures: 5MIH
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| PA-I galactophilic lectin | A | 121 | Pseudomonas Aeruginosa (Strain Atcc 15692 / Dsm 22644 / Cip 104116 / Jcm 14847 / Lmg 12228 / 1C / Prs 101 / Pao1) | AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS |
| PA-I galactophilic lectin | B | 121 | Pseudomonas Aeruginosa (Strain Atcc 15692 / Dsm 22644 / Cip 104116 / Jcm 14847 / Lmg 12228 / 1C / Prs 101 / Pao1) | AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS |
| PA-I galactophilic lectin | C | 121 | Pseudomonas Aeruginosa (Strain Atcc 15692 / Dsm 22644 / Cip 104116 / Jcm 14847 / Lmg 12228 / 1C / Prs 101 / Pao1) | AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS |
| PA-I galactophilic lectin | D | 121 | Pseudomonas Aeruginosa (Strain Atcc 15692 / Dsm 22644 / Cip 104116 / Jcm 14847 / Lmg 12228 / 1C / Prs 101 / Pao1) | AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-11-28 Deposition Author(s): Hauk, D. , Hofmann, M. , Imberty, A. , Joachim, I. , Muller, R. , Sommer, R. , Titz, A. , Varrot, A. , Wagner, S.