New insights into the role of dna shape on its recognition by p53 proteins (complex p53dbd-p53r2)
PDB DOI: 10.2210/pdb5mg7/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2016-11-21 Deposition Author(s): Braeuning, B. , Golovenko, D. , Rozenberg, H. , Shakked, Z.
New insights into the role of dna shape on its recognition by p53 proteins (complex p53dbd-p53r2)
Braeuning, B. , Golovenko, D. , Rozenberg, H. , Shakked, Z.
Primary Citation of Related Structures: 5MG7
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Cellular tumor antigen p53 | A | 200 | Homo Sapiens , Synthetic Construct | SSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKG |
| Cellular tumor antigen p53 | B | 200 | Homo Sapiens , Synthetic Construct | SSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKG |
| Nucleic Acids / Hybrid | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| DNA | c | 21 | NA | TTGACATGCCCAGGCATGTCT |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-11-21 Deposition Author(s): Braeuning, B. , Golovenko, D. , Rozenberg, H. , Shakked, Z.