Structure of the mus musclus langerin carbohydrate recognition domain in complex with glucose
PDB DOI: 10.2210/pdb5m62/pdb
Classification: IMMUNE SYSTEM Organism(s): Mus Musculus
Deposited: 2016-10-24 Deposition Author(s): Aretz, J. , Loll, B. , Rademacher, C. , Wahl, M.C.
Structure of the mus musclus langerin carbohydrate recognition domain in complex with glucose
Aretz, J. , Loll, B. , Rademacher, C. , Wahl, M.C.
Primary Citation of Related Structures: 5M62
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| C-type lectin domain family 4 member K | A | 151 | Mus Musculus | MAGILEMVARGWKYFSGNFYYFSRTPKTWYSAEQFCISRKAHLTSVSSESEQKFLYKAADGIPHWIGLTKAGSEGDWYWVDQTSFNKEQSRRFWIPGEPNNAGNNEHCANIRVSALKSWNDGPCDNTFLFICKRPYVQTTEGTWSHPQFEK |
| C-type lectin domain family 4 member K | B | 151 | Mus Musculus | MAGILEMVARGWKYFSGNFYYFSRTPKTWYSAEQFCISRKAHLTSVSSESEQKFLYKAADGIPHWIGLTKAGSEGDWYWVDQTSFNKEQSRRFWIPGEPNNAGNNEHCANIRVSALKSWNDGPCDNTFLFICKRPYVQTTEGTWSHPQFEK |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-10-24 Deposition Author(s): Aretz, J. , Loll, B. , Rademacher, C. , Wahl, M.C.