Structure of the dna-binding domain of lux arrhythmo
PDB DOI: 10.2210/pdb5lxu/pdb
Classification: DNA BINDING PROTEIN Organism(s): Arabidopsis Thaliana , Synthetic Construct
Deposited: 2016-09-22 Deposition Author(s): Nanao, M.H. , Zubieta, C.
Method: X-RAY DIFFRACTION Resolution: 2.14 Å
Structure of the dna-binding domain of lux arrhythmo
Primary Citation of Related Structures: 5LXU
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Transcription factor LUX | A | 57 | Arabidopsis Thaliana , Synthetic Construct | RPRLVWTPQLHKRFVDVVAHLGIKNAVPKTIMQLMNVEGLTRENVASHLQKYRLYLK |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-09-22 Deposition Author(s): Nanao, M.H. , Zubieta, C.