Structure of prl-1 in complex with the bateman domain of cnnm2
PDB DOI: 10.2210/pdb5lxq/pdb
Classification: METAL TRANSPORT Organism(s): Mus Musculus
Deposited: 2016-09-22 Deposition Author(s): Breiderhoff, T. , Claverie-Martin, F. , Diercks, T. , Ereno-Orbea, J. , Gimenez-Mascarell, P. , Hardy, S. , Khalaf-Nazzal, R. , Kostantin, E. , Martinez-Chantar, M.L. , Martinez-Cruz, L.A. , Muller, D. , Oyenarte, I. , Pey, A.L. , Stuiver, M. , Tremblay, M.
Structure of prl-1 in complex with the bateman domain of cnnm2
Breiderhoff, T. , Claverie-Martin, F. , Diercks, T. , Ereno-Orbea, J. , Gimenez-Mascarell, P. , Hardy, S. , Khalaf-Nazzal, R. , Kostantin, E. , Martinez-Chantar, M.L. , Martinez-Cruz, L.A. , Muller, D. , Oyenarte, I. , Pey, A.L. , Stuiver, M. , Tremblay, M.
Primary Citation of Related Structures: 5LXQ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Protein tyrosine phosphatase type IVA 1 | B | 196 | Mus Musculus | MSYYHHHHHHLESTSLYKKAGFTMARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ |
| Protein tyrosine phosphatase type IVA 1 | C | 196 | Mus Musculus | MSYYHHHHHHLESTSLYKKAGFTMARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ |
| Metal transporter CNNM2 | A | 156 | Mus Musculus | MEELNIIQGALELRTKTVEDVMTPLRDCFMITGEAILDFNTMSEIMESGYTRIPVFEGERSNIVDLLFVKDLAFVDPDDCTPLKTITKFYNHPLHFVFNDTKLDAMLEEFKKGKSHLAIVQRVNNEGEGDPFYEVLGIVTLEDVIEEIIKSEILDE |
| Metal transporter CNNM2 | H | 156 | Mus Musculus | MEELNIIQGALELRTKTVEDVMTPLRDCFMITGEAILDFNTMSEIMESGYTRIPVFEGERSNIVDLLFVKDLAFVDPDDCTPLKTITKFYNHPLHFVFNDTKLDAMLEEFKKGKSHLAIVQRVNNEGEGDPFYEVLGIVTLEDVIEEIIKSEILDE |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-09-22 Deposition Author(s): Breiderhoff, T. , Claverie-Martin, F. , Diercks, T. , Ereno-Orbea, J. , Gimenez-Mascarell, P. , Hardy, S. , Khalaf-Nazzal, R. , Kostantin, E. , Martinez-Chantar, M.L. , Martinez-Cruz, L.A. , Muller, D. , Oyenarte, I. , Pey, A.L. , Stuiver, M. , Tremblay, M.