Nmr structure of the n-terminal domain of the bacteriophage t5 decoration protein pb10
PDB DOI: 10.2210/pdb5lxl/pdb
Classification: VIRAL PROTEIN Organism(s): Escherichia Phage T5
Deposited: 2016-09-22 Deposition Author(s): Boulanger, P. , Cuniasse, P. , Gilquin, B. , Vernhes, E. , Zinn-Justin, S.
Nmr structure of the n-terminal domain of the bacteriophage t5 decoration protein pb10
Boulanger, P. , Cuniasse, P. , Gilquin, B. , Vernhes, E. , Zinn-Justin, S.
Primary Citation of Related Structures: 5LXL
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Decoration protein | A | 86 | Escherichia Phage T5 | MGIDYSGLRTIFGEKLPESHIFFATVAAHKYVPSYAFLRRELGLSSAHTNRKVWKKFVEAYGKAIPPAPPAPPLTLSKLEHHHHHH |
Method: SOLUTION NMR
Deposited Date: 2016-09-22 Deposition Author(s): Boulanger, P. , Cuniasse, P. , Gilquin, B. , Vernhes, E. , Zinn-Justin, S.