Solution structure of rtt103 ctd-interacting domain bound to a thr4 phosphorylated ctd peptide
PDB DOI: 10.2210/pdb5lvf/pdb
Classification: TRANSCRIPTION Organism(s): Grouper Iridovirus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2016-09-14 Deposition Author(s): Jasnovidova, O. , Krejcikova, M. , Kubicek, K. , Stefl, R.
Solution structure of rtt103 ctd-interacting domain bound to a thr4 phosphorylated ctd peptide
Jasnovidova, O. , Krejcikova, M. , Kubicek, K. , Stefl, R.
Primary Citation of Related Structures: 5LVF
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Regulator of Ty1 transposition protein 103 | A | 142 | Grouper Iridovirus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MAFSSEQFTTKLNTLEDSQESISSASKWLLLQYRDAPKVAEMWKEYMLRPSVNTRRKLLGLYLMNHVVQQAKGQKIIQFQDSFGKVAAEVLGRINQEFPRDLKKKLSRVVNILKERNIFSKQVVNDIERSLAAALEHHHHHH |
PRO-SER-TYR-SER-PRO-PTH-SER-PRO-SER-TYR-SER-PRO-THR-SER-PRO-SER | B | 16 | Grouper Iridovirus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | PSYSPTSPSYSPTSPS |
Method: SOLUTION NMR
Deposited Date: 2016-09-14 Deposition Author(s): Jasnovidova, O. , Krejcikova, M. , Kubicek, K. , Stefl, R.