Crystal structure of comt in complex with n-[(e)-3-[(2r,3s,4r,5r)-3,4-dihydroxy-5-[6-(methylamino)purin-9-yl]oxolan-2-yl]prop-2-enyl]-5-(4-fluorophenyl)-2,3-dihydroxybenzamide
PDB DOI: 10.2210/pdb5lqc/pdb
Classification: TRANSFERASE Organism(s): Rattus Norvegicus
Deposited: 2016-08-16 Deposition Author(s): Ehler, A. , Ellermann, M. , Lerner, C. , Rudolph, M.G.
Crystal structure of comt in complex with n-[(e)-3-[(2r,3s,4r,5r)-3,4-dihydroxy-5-[6-(methylamino)purin-9-yl]oxolan-2-yl]prop-2-enyl]-5-(4-fluorophenyl)-2,3-dihydroxybenzamide
Ehler, A. , Ellermann, M. , Lerner, C. , Rudolph, M.G.
Primary Citation of Related Structures: 5LQC
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Catechol O-methyltransferase | A | 221 | Rattus Norvegicus | MGDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPSSPDKS |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-08-16 Deposition Author(s): Ehler, A. , Ellermann, M. , Lerner, C. , Rudolph, M.G.