Solution structure of the bacterial toxin ldrd in tetrafluorethanol
PDB DOI: 10.2210/pdb5lbj/pdb
Classification: TOXIN Organism(s): N.A.
Deposited: 2016-06-16 Deposition Author(s): Meyer, N.H.
Solution structure of the bacterial toxin ldrd in tetrafluorethanol
Primary Citation of Related Structures: 5LBJ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Small toxic polypeptide LdrD | A | 35 | N.A. | MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK |
Method: SOLUTION NMR
Deposited Date: 2016-06-16 Deposition Author(s): Meyer, N.H.