Solution structure of the human snf5/ini1 domain
PDB DOI: 10.2210/pdb5l7b/pdb
Classification: DNA BINDING PROTEIN Organism(s): Homo Sapiens
Deposited: 2016-06-02 Deposition Author(s): Allen, M.D. , Bycroft, M. , Zinzalla, G.
Solution structure of the human snf5/ini1 domain
Allen, M.D. , Bycroft, M. , Zinzalla, G.
Primary Citation of Related Structures: 5L7B
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 | A | 78 | Homo Sapiens | GGSEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFSEILCDDLDLNPLTFVPAIASAIRQQIESYPTDSILEDQS |
Method: SOLUTION NMR
Deposited Date: 2016-06-02 Deposition Author(s): Allen, M.D. , Bycroft, M. , Zinzalla, G.