Nmr structure and dynamics of q4dy78, a conserved kinetoplasid-specific protein from trypanosoma cruzi
PDB DOI: 10.2210/pdb5kgq/pdb
Classification: UNKNOWN FUNCTION Organism(s): Trypanosoma Cruzi
Deposited: 2016-06-13 Deposition Author(s): D'Andrea, E.D. , Diehl, A. , Oschkinat, H. , Pires, J.R. , Retel, J.S. , Schmieder, P.
Nmr structure and dynamics of q4dy78, a conserved kinetoplasid-specific protein from trypanosoma cruzi
D'Andrea, E.D. , Diehl, A. , Oschkinat, H. , Pires, J.R. , Retel, J.S. , Schmieder, P.
Primary Citation of Related Structures: 5KGQ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Uncharacterized protein | A | 112 | Trypanosoma Cruzi | GSAMGHMVKISHEDTQRIKTAFLSYAQGQDKVTEAMIDQLICGAFPGLSWEQLQEKKKGRAAANGYDRSAFFSLVASDEQYVRFIAQHFPCAPEEEKPPEIDALELKTQKGF |
Method: SOLUTION NMR
Deposited Date: 2016-06-13 Deposition Author(s): D'Andrea, E.D. , Diehl, A. , Oschkinat, H. , Pires, J.R. , Retel, J.S. , Schmieder, P.