The structure of sav2435 bound to rhodamine 6g
PDB DOI: 10.2210/pdb5kau/pdb
Classification: UNKNOWN FUNCTION Organism(s): Staphylococcus Aureus (Strain N315)
Deposited: 2016-06-02 Deposition Author(s): Moreno, A. , Wade, H.
The structure of sav2435 bound to rhodamine 6g
Primary Citation of Related Structures: 5KAU
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| SA2223 protein | A | 165 | Staphylococcus Aureus (Strain N315) | MEYQLQQLASLTLVGIKETYENGRQAQQHIAGFWQRCYQEGVIADLQLKNNGDLAGILGLCIPELDGKMSYMIAVTGDNSADIAKYDVITLASSKYMVFEAQGAVPKAVQQKMEEVHHYIHQYQANTVKSAPFFELYQDGDTTSEKYITEIWMPVKGLEHHHHHH |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-06-02 Deposition Author(s): Moreno, A. , Wade, H.