Cal pdz mutant c319a with a peptide
PDB DOI: 10.2210/pdb5k4f/pdb
Classification: PEPTIDE BINDING PROTEIN Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2016-05-20 Deposition Author(s): Madden, D.R. , Zhao, Y.
Cal pdz mutant c319a with a peptide
Primary Citation of Related Structures: 5K4F
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Golgi-associated PDZ and coiled-coil motif-containing protein | A | 87 | Homo Sapiens , Synthetic Construct | GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRAGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV |
| Golgi-associated PDZ and coiled-coil motif-containing protein | B | 87 | Homo Sapiens , Synthetic Construct | GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRAGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV |
| HPV18E6 peptide | C | 10 | Homo Sapiens , Synthetic Construct | RLQRRRETQV |
| HPV18E6 peptide | D | 10 | Homo Sapiens , Synthetic Construct | RLQRRRETQV |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-05-20 Deposition Author(s): Madden, D.R. , Zhao, Y.