Crystal structure of lysm domain from volvox carteri chitinase
PDB DOI: 10.2210/pdb5k2l/pdb
Classification: HYDROLASE Organism(s): Rous Sarcoma Virus (Strain Schmidt-Ruppin E)
Deposited: 2016-05-19 Deposition Author(s): Fukamizo, T. , Kitaoku, Y. , Numata, T. , Ohnuma, T.
Method: X-RAY DIFFRACTION Resolution: 1.2 Å
Crystal structure of lysm domain from volvox carteri chitinase
Fukamizo, T. , Kitaoku, Y. , Numata, T. , Ohnuma, T.
Primary Citation of Related Structures: 5K2L
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Chitinase, lysozyme | A | 49 | Rous Sarcoma Virus (Strain Schmidt-Ruppin E) | MGCTYTIQPGDTFWAIAQRRGTTVDVIQSLNPGVNPARLQVGQVINVPC |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-05-19 Deposition Author(s): Fukamizo, T. , Kitaoku, Y. , Numata, T. , Ohnuma, T.