Crystal structure of lysm domain from volvox carteri chitinase
PDB DOI: 10.2210/pdb5k2l/pdb
Classification: HYDROLASE Organism(s): Volvox Carteri F. Nagariensis
Deposited: 2016-05-19 Deposition Author(s): Fukamizo, T. , Kitaoku, Y. , Numata, T. , Ohnuma, T.
Crystal structure of lysm domain from volvox carteri chitinase
Fukamizo, T. , Kitaoku, Y. , Numata, T. , Ohnuma, T.
Primary Citation of Related Structures: 5K2L
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Chitinase, lysozyme | A | 49 | Volvox Carteri F. Nagariensis | MGCTYTIQPGDTFWAIAQRRGTTVDVIQSLNPGVNPARLQVGQVINVPC |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-05-19 Deposition Author(s): Fukamizo, T. , Kitaoku, Y. , Numata, T. , Ohnuma, T.