Structure of the unbound sh3 domain of mlk3
PDB DOI: 10.2210/pdb5k28/pdb
Classification: TRANSFERASE Organism(s): Homo Sapiens
Deposited: 2016-05-18 Deposition Author(s): Kall, S.K. , Lavie, A.
Structure of the unbound sh3 domain of mlk3
Primary Citation of Related Structures: 5K28
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Mitogen-activated protein kinase kinase kinase 11 | A | 64 | Homo Sapiens | HMPVWTALFDYEPSGQDELALRKGDRVEVLSRDAAISGDEGWWAGQVGGQVGIFPSNYVSRGGG |
| Mitogen-activated protein kinase kinase kinase 11 | B | 64 | Homo Sapiens | HMPVWTALFDYEPSGQDELALRKGDRVEVLSRDAAISGDEGWWAGQVGGQVGIFPSNYVSRGGG |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-05-18 Deposition Author(s): Kall, S.K. , Lavie, A.