Nmr structure of uncharacterized protein from pseudomonas aeruginosa pao1
PDB DOI: 10.2210/pdb5jtk/pdb
Classification: UNKNOWN FUNCTION Organism(s): Pseudomonas Aeruginosa (Strain Atcc 15692 / Pao1 / 1C / Prs 101 / Lmg 12228)
Deposited: 2016-05-09 Deposition Author(s): Barnwal, R.P. , Seattle Structural Genomics Center For Infectious Disease (Ssgcid) , Varani, G.
Method: SOLUTION NMR Resolution: N.A.
Nmr structure of uncharacterized protein from pseudomonas aeruginosa pao1
Barnwal, R.P. , Seattle Structural Genomics Center For Infectious Disease (Ssgcid) , Varani, G.
Primary Citation of Related Structures: 5JTK
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Uncharacterized protein | A | 94 | Pseudomonas Aeruginosa (Strain Atcc 15692 / Pao1 / 1C / Prs 101 / Lmg 12228) | MTPIEYIDRALALVVDRLARYPGYEVLLSAEKQLQYIRSVLLDRSLDRSALHRLTLGSIAVKEFDETDPELSRALKDAYYVGIRTGRGLKVDLP |
Method: SOLUTION NMR
Deposited Date: 2016-05-09 Deposition Author(s): Barnwal, R.P. , Seattle Structural Genomics Center For Infectious Disease (Ssgcid) , Varani, G.