X-ray structure of co-bound sperm whale myoglobin using a fixed target crystallography chip
PDB DOI: 10.2210/pdb5jom/pdb
Classification: OXYGEN STORAGE Organism(s): Physeter Catodon
Deposited: 2016-05-02 Deposition Author(s): Alonso-Mori, R. , Eger, B.T. , Epp, S.W. , Ernst, O.P. , Ginn, H.M. , Kuo, A. , Lemke, H.T. , Loch, R. , Mariani, V. , Marx, A. , Miller, R.J.D. , Mueller-Werkmeister, H.M. , Nelson, S. , Oghbaey, S. , Owen, R.L. , Pare-Labrosse, O. , Pearson, A.R. , Sarracini, A. , Sherrell, D.A. , Stuart, D.I. , Zhong, Y.
X-ray structure of co-bound sperm whale myoglobin using a fixed target crystallography chip
Alonso-Mori, R. , Eger, B.T. , Epp, S.W. , Ernst, O.P. , Ginn, H.M. , Kuo, A. , Lemke, H.T. , Loch, R. , Mariani, V. , Marx, A. , Miller, R.J.D. , Mueller-Werkmeister, H.M. , Nelson, S. , Oghbaey, S. , Owen, R.L. , Pare-Labrosse, O. , Pearson, A.R. , Sarracini, A. , Sherrell, D.A. , Stuart, D.I. , Zhong, Y.
Primary Citation of Related Structures: 5JOM
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Myoglobin | A | 154 | Physeter Catodon | MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGNFGADAQGAMNKALELFRKDIAAKYKELGYQG |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-05-02 Deposition Author(s): Alonso-Mori, R. , Eger, B.T. , Epp, S.W. , Ernst, O.P. , Ginn, H.M. , Kuo, A. , Lemke, H.T. , Loch, R. , Mariani, V. , Marx, A. , Miller, R.J.D. , Mueller-Werkmeister, H.M. , Nelson, S. , Oghbaey, S. , Owen, R.L. , Pare-Labrosse, O. , Pearson, A.R. , Sarracini, A. , Sherrell, D.A. , Stuart, D.I. , Zhong, Y.