Crystal structure of the central domain of human akap18 gamma/delta in complex with malonate
PDB DOI: 10.2210/pdb5jj2/pdb
Classification: HYDROLASE Organism(s): Homo Sapiens
Deposited: 2016-04-22 Deposition Author(s): Bjerregaard-Andersen, K. , Morth, J.P. , Ostensen, E. , Scott, J.D. , Tasken, K.
Crystal structure of the central domain of human akap18 gamma/delta in complex with malonate
Bjerregaard-Andersen, K. , Morth, J.P. , Ostensen, E. , Scott, J.D. , Tasken, K.
Primary Citation of Related Structures: 5JJ2
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| A-kinase anchor protein 7 isoform gamma | A | 211 | Homo Sapiens | RKKKRKDYQPNYFLSIPITNKEIIKGIKILQNAIIQQDERLAKAMVSDGSFHITLLVMQLLNEDEVNIGIDALLELKPFIEELLQGKHLTLPFQGIGTFGNQVGFVKLAEGDHVNSLLEIAETANRTFQEKGILVGESRSFKPHLTFMKLSKSPWLRKNGVKKIDPDLYEKFISHRFGEEILYRIDLCSMLKKKQSNGYYHCESSIVIGEK |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-04-22 Deposition Author(s): Bjerregaard-Andersen, K. , Morth, J.P. , Ostensen, E. , Scott, J.D. , Tasken, K.