Crystal structure of s. pombe dcp1:edc1 mrna decapping complex
PDB DOI: 10.2210/pdb5j3q/pdb
Classification: HYDROLASE Organism(s): Conus Stercusmuscarum , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2016-03-31 Deposition Author(s): Chang, C.T. , Izaurralde, E. , Jonas, S. , Muthukumar, S. , Valkov, E. , Weichenrieder, O.
Method: X-RAY DIFFRACTION Resolution: 1.87 Å
Crystal structure of s. pombe dcp1:edc1 mrna decapping complex
Chang, C.T. , Izaurralde, E. , Jonas, S. , Muthukumar, S. , Valkov, E. , Weichenrieder, O.
Primary Citation of Related Structures: 5J3Q
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
mRNA-decapping enzyme subunit 1 | A | 130 | Conus Stercusmuscarum , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPHMEDENILRNAVNLQVLKFHYPEIESIIDIASHVAVYQFDVGSQKWLKTSIEGTFFLVKDQRARVGYVILNRNSPENLYLFINHPSNVHLVDRYLIHRTENQHVVGLWMFDPNDMSRIFNIVKESLLR |
mRNA-decapping enzyme subunit 1 | C | 130 | Conus Stercusmuscarum , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPHMEDENILRNAVNLQVLKFHYPEIESIIDIASHVAVYQFDVGSQKWLKTSIEGTFFLVKDQRARVGYVILNRNSPENLYLFINHPSNVHLVDRYLIHRTENQHVVGLWMFDPNDMSRIFNIVKESLLR |
Edc1 | B | 26 | Conus Stercusmuscarum , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SILYAGPTFTHSPAASNLPIPTFLHS |
Edc1 | D | 26 | Conus Stercusmuscarum , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SILYAGPTFTHSPAASNLPIPTFLHS |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-03-31 Deposition Author(s): Chang, C.T. , Izaurralde, E. , Jonas, S. , Muthukumar, S. , Valkov, E. , Weichenrieder, O.