Molecular insight into the regulatory mechanism of the quorum-sensing repressor rsal in pseudomonas aeruginosa
PDB DOI: 10.2210/pdb5j2y/pdb
Classification: GENE REGULATION/DNA Organism(s): Vibrio Nigripulchritudo , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2016-03-30 Deposition Author(s): Gan, J. , Kang, H. , Kong, W. , Li, F. , Liang, H. , Qin, J. , Song, Y. , Zhang, J. , Zhao, J. , Zhu, M.
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Regulatory protein | A | 80 | Vibrio Nigripulchritudo , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MASHERTQPQNMAFRAKATRTARRESQETFWSRFGISQSCGSRFENGENLPFPIYLLLHFYIEGQITDRQLADLRGKIRE |
Regulatory protein | B | 80 | Vibrio Nigripulchritudo , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MASHERTQPQNMAFRAKATRTARRESQETFWSRFGISQSCGSRFENGENLPFPIYLLLHFYIEGQITDRQLADLRGKIRE |
Method: X-RAY DIFFRACTION