Staphylococcus aureus h30n, f98y dihydrofolate reductase mutant complexed with beta-nadph and 3'-(3-(2,4-diamino-6-ethylpyrimidin-5-yl)prop-2-yn-1-yl)-4'-methoxy-[1,1'-biphenyl]-4-carboxylic acid (ucp1106)
PDB DOI: 10.2210/pdb5isq/pdb
Classification: OXIDOREDUCTASE Organism(s): Staphylococcus Aureus
Deposited: 2016-03-15 Deposition Author(s): Anderson, A.C. , Reeve, S.M.
Method: X-RAY DIFFRACTION Resolution: 1.9 Å
Staphylococcus aureus h30n, f98y dihydrofolate reductase mutant complexed with beta-nadph and 3'-(3-(2,4-diamino-6-ethylpyrimidin-5-yl)prop-2-yn-1-yl)-4'-methoxy-[1,1'-biphenyl]-4-carboxylic acid (ucp1106)
Primary Citation of Related Structures: 5ISQ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Dihydrofolate reductase | X | 160 | Staphylococcus Aureus | TLSILVAHDLQRVIGFENQLPWHLPNDLKNVKKLSTGHTLVMGRKTFESIGKPLPNRRNVVLTSDTSFNVEGVDVIHSIEDIYQLPGHVFIFGGQTLYEEMIDKVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRKLEH |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-03-15 Deposition Author(s): Anderson, A.C. , Reeve, S.M.