5IHI
Crystal structure of the alpha spectrin sh3 domain double mutant v46g-d48g
PDB DOI: 10.2210/pdb5ihi/pdb
Classification: STRUCTURAL PROTEIN Organism(s): Gallus Gallus
Deposited: 2016-02-29 Deposition Author(s): Camara-Artigas, A.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.45 Å
Crystal structure of the alpha spectrin sh3 domain double mutant v46g-d48g
Primary Citation of Related Structures: 5IHI
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Spectrin alpha chain, non-erythrocytic 1 | A | 62 | Gallus Gallus | MDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEGNGRQGFVPAAYVKKLD |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2016-02-29 Deposition Author(s): Camara-Artigas, A.