Crystal structure of the oligomeric form of the lassa virus matrix protein z
PDB DOI: 10.2210/pdb5i72/pdb
Classification: VIRAL PROTEIN Organism(s): Lassa Virus (Strain Mouse/Sierra Leone/Josiah/1976)
Deposited: 2016-02-16 Deposition Author(s): Hastie, K. , Li, S. , Liu, T. , Saphire, E.O. , Woods Jr, V. , Zandonatti, M.
Crystal structure of the oligomeric form of the lassa virus matrix protein z
Hastie, K. , Li, S. , Liu, T. , Saphire, E.O. , Woods Jr, V. , Zandonatti, M.
Primary Citation of Related Structures: 5I72
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| RING finger protein Z | A | 53 | Lassa Virus (Strain Mouse/Sierra Leone/Josiah/1976) | HLGPQFCKSCWFENKGLVECNNHYLCLNCLTLLLSVSNRCPICKMPLPTKLRP |
| RING finger protein Z | B | 53 | Lassa Virus (Strain Mouse/Sierra Leone/Josiah/1976) | HLGPQFCKSCWFENKGLVECNNHYLCLNCLTLLLSVSNRCPICKMPLPTKLRP |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-02-16 Deposition Author(s): Hastie, K. , Li, S. , Liu, T. , Saphire, E.O. , Woods Jr, V. , Zandonatti, M.