Structure of omomyc bound to double-stranded dna
PDB DOI: 10.2210/pdb5i50/pdb
Classification: TRANSCRIPTION Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2016-02-13 Deposition Author(s): Eilers, M. , Jung, L.A. , Kisker, C. , Koelmel, W. , Kuper, J.
Structure of omomyc bound to double-stranded dna
Eilers, M. , Jung, L.A. , Kisker, C. , Koelmel, W. , Kuper, J.
Primary Citation of Related Structures: 5I50
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Myc proto-oncogene protein | A | 118 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MKHHHHHHPMSDYDIPTTENLYFQGAMATEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAETQKLISEIDLLRKQNEQLKHKLEQLRNSCA |
Myc proto-oncogene protein | B | 118 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MKHHHHHHPMSDYDIPTTENLYFQGAMATEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAETQKLISEIDLLRKQNEQLKHKLEQLRNSCA |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-02-13 Deposition Author(s): Eilers, M. , Jung, L.A. , Kisker, C. , Koelmel, W. , Kuper, J.