Crystal structure of non-phosphorylated receiver domain of the stress response regulator rcsb from escherichia coli
PDB DOI: 10.2210/pdb5i4c/pdb
Classification: GENE REGULATION Organism(s): Escherichia Coli (Strain K12)
Deposited: 2016-02-11 Deposition Author(s): Anderson, W.F. , Center For Structural Genomics Of Infectious Diseases (Csgid) , Filippova, E.V. , Minasov, G. , Pshenychnyi, S. , Ruan, J. , Wawrzak, Z. , Wolfe, A.J.
Crystal structure of non-phosphorylated receiver domain of the stress response regulator rcsb from escherichia coli
Anderson, W.F. , Center For Structural Genomics Of Infectious Diseases (Csgid) , Filippova, E.V. , Minasov, G. , Pshenychnyi, S. , Ruan, J. , Wawrzak, Z. , Wolfe, A.J.
Primary Citation of Related Structures: 5I4C
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Transcriptional regulatory protein RcsB | A | 147 | Escherichia Coli (Strain K12) | MNNMNVIIADDHPIVLFGIRKSLEQIEWVNVVGEFEDSTALINNLPKLDAHVLITDLSMPGDKYGDGITLIKYIKRHFPSLSIIVLTMNNNPAILSAVLDLDIEGIVLKQGAPTDLPKALAALQKGKKFTPESVSRLLEKISAGGYG |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-02-11 Deposition Author(s): Anderson, W.F. , Center For Structural Genomics Of Infectious Diseases (Csgid) , Filippova, E.V. , Minasov, G. , Pshenychnyi, S. , Ruan, J. , Wawrzak, Z. , Wolfe, A.J.