Crystal structure of the intertwined form of the src tyrosine kinase sh3 domain t114s-q128r mutant
PDB DOI: 10.2210/pdb5i11/pdb
Classification: SIGNALING PROTEIN Organism(s): Gallus Gallus
Deposited: 2016-02-05 Deposition Author(s): Camara-Artigas, A.
Crystal structure of the intertwined form of the src tyrosine kinase sh3 domain t114s-q128r mutant
Primary Citation of Related Structures: 5I11
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Proto-oncogene tyrosine-protein kinase Src | A | 61 | Gallus Gallus | GSHMTFVALYDYESRTETDLSFKKGERLQIVNNSEGDWWLAHSLTTGRTGYIPSNYVAPSD |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-02-05 Deposition Author(s): Camara-Artigas, A.