Crystal structure of beta-lactamase from burkholderia vietnamiensis
PDB DOI: 10.2210/pdb5hx9/pdb
Classification: HYDROLASE Organism(s): Burkholderia Vietnamiensis (Strain G4 / Lmg 22486)
Deposited: 2016-01-29 Deposition Author(s): Seattle Structural Genomics Center For Infectious Disease (Ssgcid)
Crystal structure of beta-lactamase from burkholderia vietnamiensis
Seattle Structural Genomics Center For Infectious Disease (Ssgcid)
Primary Citation of Related Structures: 5HX9
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Beta-lactamase | A | 283 | Burkholderia Vietnamiensis (Strain G4 / Lmg 22486) | MAHHHHHHSAPIADQGRAHVARSELAALDKASNGRLGVAALDTSNGTRIAHHARERFPLCGTYAVVAAAAILARASLDASLLPRRILYRRYEVVAGSPVTESHVDTGMTIAQLCAAMLQSGDKGAGNLLMNVLGGPQAVTAFAHESGDTVFRLDRWEPELNRAAPGDERDTSTPVAMVDTLQRLLLGDTLQQAQRAQLTDWMTAGAPDATGIAAGVPPGSRVAAKRGTGGYGTTTEVAVVWPPSRAPIVLAVSFTQAQADAAARADVVASAARIATGALTATA |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-01-29 Deposition Author(s): Seattle Structural Genomics Center For Infectious Disease (Ssgcid)