Solution structure of coiled coil domain of myosin binding subunit of myosin light chain phosphatase
PDB DOI: 10.2210/pdb5huz/pdb
Classification: SIGNALING PROTEIN Organism(s): Homo Sapiens
Deposited: 2016-01-27 Deposition Author(s): Alper, S.L. , Anklin, C. , Birrane, G. , Pollak, M. , Rigby, A.C. , Sharma, A.K.
Solution structure of coiled coil domain of myosin binding subunit of myosin light chain phosphatase
Alper, S.L. , Anklin, C. , Birrane, G. , Pollak, M. , Rigby, A.C. , Sharma, A.K.
Primary Citation of Related Structures: 5HUZ
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Protein phosphatase 1 regulatory subunit 12A | A | 48 | Homo Sapiens | DFKKLYEQILAENEKLKAQLHDTNMELTDLKLQLEKATQRQERFADRS |
Protein phosphatase 1 regulatory subunit 12A | B | 48 | Homo Sapiens | DFKKLYEQILAENEKLKAQLHDTNMELTDLKLQLEKATQRQERFADRS |
Method: SOLUTION NMR
Deposited Date: 2016-01-27 Deposition Author(s): Alper, S.L. , Anklin, C. , Birrane, G. , Pollak, M. , Rigby, A.C. , Sharma, A.K.