The third pdz domain from the synaptic protein psd-95 (h372a mutant) in complex with a c-terminal peptide derived from cript
PDB DOI: 10.2210/pdb5hfb/pdb
Classification: PEPTIDE BINDING PROTEIN Organism(s): Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2016-01-06 Deposition Author(s): Raman, A.S. , Ranganathan, R. , White, K.I.
The third pdz domain from the synaptic protein psd-95 (h372a mutant) in complex with a c-terminal peptide derived from cript
Raman, A.S. , Ranganathan, R. , White, K.I.
Primary Citation of Related Structures: 5HFB
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Disks large homolog 4 | A | 119 | Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSPEFLGEEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASAEQAAIALKNAGQTVTIIAQYKPEEYSRFEANSRVDSSGRIVTD |
Cysteine-rich PDZ-binding protein | B | 9 | Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | TKNYKQTSV |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-01-06 Deposition Author(s): Raman, A.S. , Ranganathan, R. , White, K.I.