Crystal structure of transcription factor tead4 in complex with m-cat dna
PDB DOI: 10.2210/pdb5gzb/pdb
Classification: TRANSCRIPTION/DNA Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2016-09-28 Deposition Author(s): He, F. , Shi, Z.B. , Zhou, Z.C.
Crystal structure of transcription factor tead4 in complex with m-cat dna
He, F. , Shi, Z.B. , Zhou, Z.C.
Primary Citation of Related Structures: 5GZB
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Transcriptional enhancer factor TEF-3 | A | 107 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | STMDNDAEGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKAREIQAKLKDQAAKDKALQSMAAMSSAQII |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-09-28 Deposition Author(s): He, F. , Shi, Z.B. , Zhou, Z.C.