Solution structure of heterodimeric coiled-coil domain of drosophila gabab receptor 1 and 3
PDB DOI: 10.2210/pdb5gwm/pdb
Classification: SIGNALING PROTEIN Organism(s): Drosophila Melanogaster
Deposited: 2016-09-12 Deposition Author(s): Liu, J. , Liu, X. , Zhang, C.X. , Zhang, S.
Solution structure of heterodimeric coiled-coil domain of drosophila gabab receptor 1 and 3
Liu, J. , Liu, X. , Zhang, C.X. , Zhang, S.
Primary Citation of Related Structures: 5GWM
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence | 
| Metabotropic GABA-B receptor subtype 1 | A | 53 | Drosophila Melanogaster | MDSAISKEDEERYQKLVTENEQLQRLITQKEEKIRVLRQRLVERGDAKGTELN | 
| Metabotropic GABA-B receptor subtype 3, isoform A | B | 50 | Drosophila Melanogaster | GPLGSRRFVVDDRRELQYRVEVQNRVYKKEIQALDAEIRKLERLLESGLT | 
Method: SOLUTION NMR
Deposited Date: 2016-09-12 Deposition Author(s): Liu, J. , Liu, X. , Zhang, C.X. , Zhang, S.