Structure of biotin carboxyl carrier protein from pyrococcus horikoshi ot3 (delta n79) a138i mutant
PDB DOI: 10.2210/pdb5gu9/pdb
Classification: TRANSFERASE Organism(s): Pyrococcus Horikoshii (Strain Atcc 700860 / Dsm 12428 / Jcm 9974 / Nbrc 100139 / Ot-3)
Deposited: 2016-08-26 Deposition Author(s): Fukasawa, Y. , Kunishima, N. , Matsuura, Y. , Naitow, H. , Nakai, K. , Tomii, K. , Yamada, K.
Method: X-RAY DIFFRACTION Resolution: 1.9 Å
Structure of biotin carboxyl carrier protein from pyrococcus horikoshi ot3 (delta n79) a138i mutant
Fukasawa, Y. , Kunishima, N. , Matsuura, Y. , Naitow, H. , Nakai, K. , Tomii, K. , Yamada, K.
Primary Citation of Related Structures: 5GU9
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| 149aa long hypothetical methylmalonyl-CoA decarboxylase gamma chain | A | 71 | Pyrococcus Horikoshii (Strain Atcc 700860 / Dsm 12428 / Jcm 9974 / Nbrc 100139 / Ot-3) | MENVVSAPMPGKVLRVLVRVGDRVRVGQGLLVLEAMKMENEIPSPRDGVVKRILVKEGEIVDTGQPLIELG |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-08-26 Deposition Author(s): Fukasawa, Y. , Kunishima, N. , Matsuura, Y. , Naitow, H. , Nakai, K. , Tomii, K. , Yamada, K.