Solution nmr structure of the wild type dna binding domain of area complexed to a 13bp dna containing a cgata site, 35 structures
PDB DOI: 10.2210/pdb5gat/pdb
Classification: TRANSCRIPTION/DNA Organism(s): Emericella Nidulans , Synthetic Construct
Deposited: 1997-11-07 Deposition Author(s): Clore, G.M. , Gronenborn, A.M. , Starich, M. , Wikstrom, M.
Solution nmr structure of the wild type dna binding domain of area complexed to a 13bp dna containing a cgata site, 35 structures
Clore, G.M. , Gronenborn, A.M. , Starich, M. , Wikstrom, M.
Primary Citation of Related Structures: 5GAT
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| NITROGEN REGULATORY PROTEIN AREA | A | 66 | Emericella Nidulans , Synthetic Construct | MKNGEQNGPTTCTNCFTQTTPLWRRNPEGQPLCNACGLFLKLHGVVRPLSLKTDVIKKRNRNSANS |
Method: SOLUTION NMR
Deposited Date: 1997-11-07 Deposition Author(s): Clore, G.M. , Gronenborn, A.M. , Starich, M. , Wikstrom, M.