Crystal structure of danio rerio hdac6 znf-ubp domain
PDB DOI: 10.2210/pdb5g0f/pdb
Classification: CELL CYCLE Organism(s): Danio Rerio
Deposited: 2016-03-18 Deposition Author(s): Gut, H. , Helquist, P. , Hess, D. , Keusch, J.J. , Matthias, P. , Melancon, B.J. , Miyake, Y. , Saito, M. , Wang, L. , Wang, X.
Crystal structure of danio rerio hdac6 znf-ubp domain
Gut, H. , Helquist, P. , Hess, D. , Keusch, J.J. , Matthias, P. , Melancon, B.J. , Miyake, Y. , Saito, M. , Wang, L. , Wang, X.
Primary Citation of Related Structures: 5G0F
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| HDAC6 | A | 110 | Danio Rerio | GPDPLPWCPHLESVRPVPAGGIDVFQPCEECGGEAENWICLFCYKVLCGRYVNQHMVTHGQESGHPVVLSFADLSVWCYACESYVHNKVLHEAKNAAHLVKFGEGIHPFN |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-03-18 Deposition Author(s): Gut, H. , Helquist, P. , Hess, D. , Keusch, J.J. , Matthias, P. , Melancon, B.J. , Miyake, Y. , Saito, M. , Wang, L. , Wang, X.