Crystal structure of the bromodomain of human brpf1 in complex with h4k5ack8ac histone peptide
PDB DOI: 10.2210/pdb5ffw/pdb
Classification: TRANSCRIPTION Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2015-12-19 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Edwards, A.M. , Knapp, S. , Krojer, T. , Nunez-Alonso, G. , Savitsky, P. , Tallant, C. , Von Delft, F.
Method: X-RAY DIFFRACTION Resolution: 1.5 Å
Crystal structure of the bromodomain of human brpf1 in complex with h4k5ack8ac histone peptide
Arrowsmith, C.H. , Bountra, C. , Edwards, A.M. , Knapp, S. , Krojer, T. , Nunez-Alonso, G. , Savitsky, P. , Tallant, C. , Von Delft, F.
Primary Citation of Related Structures: 5FFW
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Peregrin | A | 116 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SMEMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKMG |
Peregrin | B | 116 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SMEMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKMG |
Histone H4 | C | 10 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SGRGKGGKGL |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-12-19 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Edwards, A.M. , Knapp, S. , Krojer, T. , Nunez-Alonso, G. , Savitsky, P. , Tallant, C. , Von Delft, F.