5EQ0
Crystal structure of chromodomain of cbx8 in complex with inhibitor unc3866
PDB DOI: 10.2210/pdb5eq0/pdb
Classification: transcription/transcription inhibitor Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2015-11-12 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Dickson, B.M. , Edwards, A.M. , Frye, S.V. , James, L.I. , Liu, Y. , Min, J. , Structural Genomics Consortium (Sgc) , Stuckey, J.I. , Tempel, W. , Walker, J.R.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.18 Å
Crystal structure of chromodomain of cbx8 in complex with inhibitor unc3866
Arrowsmith, C.H. , Bountra, C. , Dickson, B.M. , Edwards, A.M. , Frye, S.V. , James, L.I. , Liu, Y. , Min, J. , Structural Genomics Consortium (Sgc) , Stuckey, J.I. , Tempel, W. , Walker, J.R.
Primary Citation of Related Structures: 5EQ0
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Chromobox protein homolog 8 | A | 55 | Homo Sapiens , Synthetic Construct | GERVFAAEALLKRRIRKGRMEYLVKWKGWSQKYSTWEPEENILDARLLAAFEERE |
| unc3866 | B | 6 | Homo Sapiens , Synthetic Construct | XFALXX |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2015-11-12 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Dickson, B.M. , Edwards, A.M. , Frye, S.V. , James, L.I. , Liu, Y. , Min, J. , Structural Genomics Consortium (Sgc) , Stuckey, J.I. , Tempel, W. , Walker, J.R.