Crystal structure of a chimeric c-src-sh3 domain with the sequence of the rt-loop from the abl-sh3 domain at ph 5.0
PDB DOI: 10.2210/pdb5ec7/pdb
Classification: TRANSFERASE Organism(s): Gallus Gallus
Deposited: 2015-10-20 Deposition Author(s): Camara-Artigas, A.
Crystal structure of a chimeric c-src-sh3 domain with the sequence of the rt-loop from the abl-sh3 domain at ph 5.0
Primary Citation of Related Structures: 5EC7
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Proto-oncogene tyrosine-protein kinase Src | A | 57 | Gallus Gallus | MTFVALYDYVASGETDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPS |
Proto-oncogene tyrosine-protein kinase Src | B | 57 | Gallus Gallus | MTFVALYDYVASGETDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPS |
Proto-oncogene tyrosine-protein kinase Src | C | 57 | Gallus Gallus | MTFVALYDYVASGETDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPS |
Method: X-RAY DIFFRACTION
Deposited Date: 2015-10-20 Deposition Author(s): Camara-Artigas, A.