PDBi (Protein Data Bank in India)

All in One Protein Databank
Home About Help Resources External Links Contact Us
Advanced Search
FASTA Sequence PDB Format mmCIF Format
FASTA Sequence PDB Format PDB Format(gz) PDBx/mmCIF Format PDBx/mmCIF Format(gz) PDBML/XML Format Validation Full PDF Validation CIF

5DZD

Crystal structure of ww4 domain of itch in complex with txnip peptide

PDB DOI: 10.2210/pdb5dzd/pdb

Classification: LIGASE/PROTEIN BINDING
Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)

Deposited: 2015-09-25
Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Dong, A. , Edwards, A.M. , Liu, Y. , Min, J. , Structural Genomics Consortium (Sgc) , Tempel, W.

Experimental Data Snapshot

Method: X-RAY DIFFRACTION
Resolution: 1.57 Å

5dzd
Literature

Crystal structure of ww4 domain of itch in complex with txnip peptide

Arrowsmith, C.H. , Bountra, C. , Dong, A. , Edwards, A.M. , Liu, Y. , Min, J. , Structural Genomics Consortium (Sgc) , Tempel, W.

Primary Citation of Related Structures: 5DZD


Proteins
Molecule Chains Sequence Length Organism Sequence
E3 ubiquitin-protein ligase Itchy homolog A 47 Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) GRRASVELNEKPLPEGWEMRFTVDGIPYFVDHNRRTTTYIDPRTGKS
E3 ubiquitin-protein ligase Itchy homolog B 47 Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) GRRASVELNEKPLPEGWEMRFTVDGIPYFVDHNRRTTTYIDPRTGKS
Thioredoxin-interacting protein C 14 Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) XTPEAPPCYMDVIX
Thioredoxin-interacting protein D 14 Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) XTPEAPPCYMDVIX
Experimental Data

Method: X-RAY DIFFRACTION

Deposited Date: 2015-09-25
Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Dong, A. , Edwards, A.M. , Liu, Y. , Min, J. , Structural Genomics Consortium (Sgc) , Tempel, W.